Protein Info for AO353_20795 in Pseudomonas fluorescens FW300-N2E3

Annotation: deoxyribonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 57% identical to DRNE_VIBCH: Extracellular deoxyribonuclease (dns) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01150, deoxyribonuclease I [EC: 3.1.21.1] (inferred from 90% identity to pfl:PFL_2097)

MetaCyc: 52% identical to DNA-specific endonuclease I (Escherichia coli K-12 substr. MG1655)
Deoxyribonuclease I. [EC: 3.1.21.1]

Predicted SEED Role

"Endonuclease I precursor (EC 3.1.21.1)" (EC 3.1.21.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VS83 at UniProt or InterPro

Protein Sequence (230 amino acids)

>AO353_20795 deoxyribonuclease (Pseudomonas fluorescens FW300-N2E3)
MIARCFALLLLLFVVISAQADAPRTFNEAKKVAWTLYAPQSTEFYCGCKYTGNRVDLKAC
GYVPRKNAKRAARIEWEHIVPAWQIGHQRQCWQQGGRQNCTRHDPTYQRAEADLHNLVPS
IGEVNGDRSNFSFGWLPVQSGQYGSCLTQVDFKAKKVMPRPSIRGMIARTYFYMSKQYGL
RLSKQDRQLYEAWNKTYPAQRWERQRNQRVACVMGRGNEFVGPVNMKACG