Protein Info for AO353_20670 in Pseudomonas fluorescens FW300-N2E3

Annotation: acetyl-CoA carboxylase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00515: acetyl-CoA carboxylase, carboxyl transferase, beta subunit
  • amino acids 15 to 283 (269 residues), 429.5 bits, E=3e-133
• PF17848: zf-ACC
  • amino acids 28 to 53 (26 residues), 41.8 bits, see alignment (E = 9.8e-15)
• PF01039: Carboxyl_trans
  • amino acids 95 to 241 (147 residues), 68.3 bits, E=5.6e-23

Best Hits

Swiss-Prot: 98% identical to ACCD_PSEF5: Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K01963, acetyl-CoA carboxylase carboxyl transferase subunit beta [EC: 6.4.1.2] (inferred from 98% identity to pfl:PFL_2073)

MetaCyc: 70% identical to acetyl-CoA carboxyltransferase subunit beta (Escherichia coli K-12 substr. MG1655)
RXN0-5055 [EC: 2.1.3.15]

Predicted SEED Role

"Acetyl-coenzyme A carboxyl transferase beta chain (EC 6.4.1.2)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.4.1.2)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (49/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (15/16 steps found)
• biotin-carboxyl carrier protein assembly (4/4 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• superpathway of fatty acid biosynthesis initiation (4/5 steps found)
• fatty acid biosynthesis initiation (type I) (1/3 steps found)
• propanoyl CoA degradation I (1/3 steps found)
• 2-oxobutanoate degradation I (1/4 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (4/10 steps found)
• candicidin biosynthesis (1/6 steps found)
• jadomycin biosynthesis (3/9 steps found)
• superpathway of L-methionine salvage and degradation (8/16 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (8/17 steps found)
• 3-hydroxypropanoate cycle (5/13 steps found)
• methylaspartate cycle (9/19 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (8/18 steps found)
• glyoxylate assimilation (4/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (5/18 steps found)
• superpathway of mycolate biosynthesis (21/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis
• Propanoate metabolism
• Pyruvate metabolism
• Tetracycline biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 2.1.3.15 or 6.4.1.2

Sequence Analysis Tools

See A0A0N9VXA9 at UniProt or InterPro

Protein Sequence (306 amino acids)

>AO353_20670 acetyl-CoA carboxylase subunit beta (Pseudomonas fluorescens FW300-N2E3)
MSNWLVDKLIPSIMRSEVKKSSVPEGLWHKCPSCEAVLYRPELEKTLDVCPKCNHHMRIG
ARARIDIFLDAEGRAELGADLEPVDRLKFRDGKKYKDRLTAAQKQTGEKDALISMSGTLL
GMPVVVSAFEFSFMGGSMGAIVGERFVRAANYALENRCPMICFAASGGARMQEALISLMQ
MAKTSAVLARLREEGIPFISVLTDPVYGGVSASLAMLGDVIVGEPKALIGFAGPRVIEQT
VREKLPEGFQRSEFLLEHGAIDMIIARQELRPRLGNLLAQLMGLPTPEFVAAPVEPIVVP
PVPANL