Protein Info for AO353_20520 in Pseudomonas fluorescens FW300-N2E3

Annotation: NAD synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF02540: NAD_synthase" amino acids 28 to 271 (244 residues), 214 bits, see alignment E=9.1e-68 TIGR00552: NAD+ synthetase" amino acids 32 to 272 (241 residues), 228.5 bits, see alignment E=3.9e-72

Best Hits

Swiss-Prot: 61% identical to NADE_PSE14: NH(3)-dependent NAD(+) synthetase (nadE) from Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)

KEGG orthology group: K01916, NAD+ synthase [EC: 6.3.1.5] (inferred from 85% identity to pba:PSEBR_a5642)

Predicted SEED Role

"NAD synthetase (EC 6.3.1.5)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 6.3.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.5

Use Curated BLAST to search for 6.3.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W8I9 at UniProt or InterPro

Protein Sequence (276 amino acids)

>AO353_20520 NAD synthetase (Pseudomonas fluorescens FW300-N2E3)
MTMQRQERIARELGIDRQLAQGGEAAEIVRRVDFIKQVLRESGCKALVLGISGGVDSLTA
GRLCQLAVEQLRAEDHEARFIAVRLPYKTQADERDAQASLDFIQPDLITTSNIADCVDGL
MVNIAIDGLQPSAELTDFAKGNVKARARMLAQYAIANFCNGLVVGTDHGAEALMGFFTKF
GDGACDLAPLSGLIKSQVRLLADALGAPTHLVRKAPTADLEDLAPGKLDEAAYGCSYEEI
DAYLMGEAVSQQAQQIIESAYIKTAHKRELPRVPRP