Protein Info for AO353_20445 in Pseudomonas fluorescens FW300-N2E3

Annotation: ribonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00445: Ribonuclease_T2" amino acids 39 to 201 (163 residues), 55.2 bits, see alignment E=5.3e-19

Best Hits

KEGG orthology group: None (inferred from 76% identity to pfo:Pfl01_3807)

Predicted SEED Role

"Ribonuclease precursor (EC 3.1.27.-)" (EC 3.1.27.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.27.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WN42 at UniProt or InterPro

Protein Sequence (220 amino acids)

>AO353_20445 ribonuclease (Pseudomonas fluorescens FW300-N2E3)
MKKLYALVALFALTIGSVGMSDARSHRDKQQTESVAGVFDYYLLTLSWSPTFCLTHQNNP
QCSGKGYGFVLHGLWPQYAKGGWPESCPPMVPLSPAEQKQGLTLFVTPKLLQHEWSKHGT
CSGLGASGYLDMADKAVGTVKIPDKLKPLSTEIYFPAQEIAQMFRQSNPGIPADGIAIVC
NGPELSEVRVCLGKDLSFGSCGKGVKSQCRAGDIRVPPMR