Protein Info for AO353_20405 in Pseudomonas fluorescens FW300-N2E3

Annotation: transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 PF00872: Transposase_mut" amino acids 28 to 390 (363 residues), 388.3 bits, see alignment E=1.8e-120

Best Hits

Swiss-Prot: 58% identical to TRA3_RHIME: Transposase for insertion sequence element ISRM3 (R00164) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 94% identity to ppw:PputW619_3315)

Predicted SEED Role

"putative transposase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W8H7 at UniProt or InterPro

Protein Sequence (416 amino acids)

>AO353_20405 transposase (Pseudomonas fluorescens FW300-N2E3)
MPTKKKPALRELPKIPKELLEQFTDGPMTAEAIEDASAAFKKALIERALSAELGHHLGYP
PGAQRPEDETNQRNGKSGKTVLTGDGPLRLDIPRDRDGSFSPILIPKHERRYTGFDDKII
AMYARGMTVREIRAFLSEQYGTDVSPDFISSVTDEVMAEIGAWQQRPLEPMYPVIFFDAL
RVKIREEGLVRNKAIYLALGVLPDGTRDILGIWIENTEGAKFWMKVFNDLKTRGVEDVLI
AVTDGLKGMPEALNAVFPDTTLQTCVVHLIRNSLDYAAWDKRRELAKALKPIYQAVTAEA
AEQALDAFENGPWGKQYPTVVAAWRRAWDRVIPFFVFPPAIRKVIYTTNAIESINAQLRK
IIKTRGHFPTDDAATKLIWLGLRNITANWGSAAHDWKSAMNQFAILYGDRLIRPTW