Protein Info for AO353_20395 in Pseudomonas fluorescens FW300-N2E3

Annotation: GMP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 74 to 98 (25 residues), see Phobius details PF00117: GATase" amino acids 27 to 168 (142 residues), 63.6 bits, see alignment E=2e-21 PF07722: Peptidase_C26" amino acids 73 to 113 (41 residues), 26 bits, see alignment 7.3e-10

Best Hits

KEGG orthology group: None (inferred from 35% identity to ljo:LJ0690)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VS49 at UniProt or InterPro

Protein Sequence (217 amino acids)

>AO353_20395 GMP synthase (Pseudomonas fluorescens FW300-N2E3)
MPEQSTSLNLIQHHPAEGPGAIDDWAESRGLTLKVFRADLGQLPPAGAAPVIILGGPYEA
NAGPQWLAEERKWLAASIAQGAPVFAICLGAQLLALSLGGNVRRMARTETGWTQVTFADG
HALNVLEWHEDAIDLPPDARLLASSAQCEQQMYAVGSTRVGLQFHPEWNAESVALLNAHF
GNESPLPRDQDDSAAYRLVFDWLQATLDEWHATASGV