Protein Info for AO353_20385 in Pseudomonas fluorescens FW300-N2E3

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 40 to 175 (136 residues), 58.7 bits, see alignment E=1e-19 PF00165: HTH_AraC" amino acids 225 to 264 (40 residues), 27 bits, see alignment 5.6e-10 PF12833: HTH_18" amino acids 236 to 315 (80 residues), 83.3 bits, see alignment E=1.9e-27

Best Hits

KEGG orthology group: K13633, AraC family transcriptional regulator, transcriptional activator FtrA (inferred from 87% identity to pfo:Pfl01_2062)

Predicted SEED Role

"transcriptional activator FtrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VXN5 at UniProt or InterPro

Protein Sequence (325 amino acids)

>AO353_20385 transcriptional regulator (Pseudomonas fluorescens FW300-N2E3)
MHTEPGLVAILAYDGLCTFEFGIAVEIFGLARPEFDFPWYEHRIVAVDQGPMRAMGGIQV
LADGGMELLDTARTIIIPGWRSRTEPVPEALLSALRQAHARGARLLSICSGVFVLAATGL
LDGLSATTHWRYTEELSERFPNILVDPDVLYVDAGQLITSAGSAAGIDACLHLVARDFGT
QVANSVARRLVMSPQRTGGQAQFIPAPVSRTPRSDLSRVMQWARERLHEPLGVRELASQA
AMSERTFLRRFSEATGASPKSWLQQQRLARARELLESSAHNTESIALQCGYRSVESFRVA
FRSVVGLPPSVYRERFGREVKTLSM