Protein Info for AO353_20340 in Pseudomonas fluorescens FW300-N2E3

Annotation: gamma-carboxygeranoyl-CoA hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 15 to 263 (249 residues), 155.7 bits, E=1.4e-49
• PF16113: ECH_2
  • amino acids 18 to 194 (177 residues), 93.7 bits, E=1.7e-30

Best Hits

KEGG orthology group: K13766, methylglutaconyl-CoA hydratase [EC: 4.2.1.18] (inferred from 92% identity to pfo:Pfl01_3658)

MetaCyc: 78% identical to 3-methylglutaconyl-CoA hydratase (Pseudomonas putida)
Methylglutaconyl-CoA hydratase. [EC: 4.2.1.18]

Predicted SEED Role

"Methylglutaconyl-CoA hydratase (EC 4.2.1.18)" in subsystem Benzoate transport and degradation cluster or HMG CoA Synthesis or Leucine Degradation and HMG-CoA Metabolism (EC 4.2.1.18)

MetaCyc Pathways

• L-leucine degradation I (5/6 steps found)
• ferrichrome A biosynthesis (1/5 steps found)

KEGG Metabolic Maps

• Valine, leucine and isoleucine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.18

Sequence Analysis Tools

See A0A0N9VS41 at UniProt or InterPro

Protein Sequence (271 amino acids)

>AO353_20340 gamma-carboxygeranoyl-CoA hydratase (Pseudomonas fluorescens FW300-N2E3)
MSDFNTLELLTDPRGFATLWLSREAKNNAFNAEMIRELILALDKVQSNPSLRFLLVRGRG
KHFSAGADLAWMQQSAELDYHTNLDDARELAELMYNLAKLKIPTLAVVQGAAYGGALGLI
SCCDMAIGADDAQFCLSEVRIGLAPAVISPFVVQAIGERAARRYALTAERFSGQRAQEIG
LLSESYPASELESQVEQWINNLLLNSPHAMRSSKELLREVGNGALNPALRRYCENAIARI
RVSPEGQEGLRAFLQKRPPSWQSESTTKELR