Protein Info for AO353_20315 in Pseudomonas fluorescens FW300-N2E3

Annotation: cytochrome B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 transmembrane" amino acids 14 to 37 (24 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 7 to 176 (170 residues), 103.1 bits, see alignment E=7.9e-34

Best Hits

KEGG orthology group: None (inferred from 84% identity to pfl:PFL_3945)

Predicted SEED Role

"Cytochrome B561, bacterial precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WL11 at UniProt or InterPro

Protein Sequence (180 amino acids)

>AO353_20315 cytochrome B (Pseudomonas fluorescens FW300-N2E3)
MSAHPHHFTPLARLLHWLMAVMVVAMLFIGAGMVASVSERHEWLIHLHKPLGVAILLLVI
VRLFVRFSTRQPPLPTDLPGWQALAAKASHGLLYALMLILPLLGWAMISAAGDPVMLGSS
WQLPAIVPANALLFAFLRRAHGYLAYLLFLTVLSHLAAALFHGWVRRDGVLQSMLHSKDH