Protein Info for AO353_20070 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details PF01988: VIT1" amino acids 19 to 226 (208 residues), 216.8 bits, see alignment E=1.6e-68

Best Hits

KEGG orthology group: None (inferred from 78% identity to ppf:Pput_2740)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VS14 at UniProt or InterPro

Protein Sequence (233 amino acids)

>AO353_20070 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
MKFFRRHAESHKHERIGWLRAAVLGANDGIVSTASLLIGVAAANATHSTLLVTGVAGLVA
GAMSMAAGEYVSVHSQADTERADLLREQTELETAPLAEHRELAAIYVDRGVEPELASKVA
TQLMAHDALGSHARDELGISDALSAKPLQAAMSSAASFVVGAALPLGVTILAPTHSVIAW
ISGMSLVFLGTLGGIAAKAGGANLLIGAWRVTLWGALAMAITAAVGISFGAVA