Protein Info for AO353_19970 in Pseudomonas fluorescens FW300-N2E3

Annotation: peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 42 to 70 (29 residues), see Phobius details amino acids 83 to 106 (24 residues), see Phobius details amino acids 112 to 129 (18 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details PF01694: Rhomboid" amino acids 42 to 190 (149 residues), 117 bits, see alignment E=7.7e-38 PF08551: DUF1751" amino acids 42 to 104 (63 residues), 22.8 bits, see alignment E=1.1e-08

Best Hits

KEGG orthology group: None (inferred from 62% identity to bpy:Bphyt_5548)

Predicted SEED Role

"integral membrane rhomboid family serine protease MJ0610.1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VWZ4 at UniProt or InterPro

Protein Sequence (197 amino acids)

>AO353_19970 peptidase (Pseudomonas fluorescens FW300-N2E3)
MTIALIVLNFAAFLLEMSDPNRIVSEFALWPLSPADADQPPFYLWQMVTYSVLHANVTHL
AFNMLGLYMFGRDVERTLGRVRLVTLYLASVVSGAVVQVVVALLSLHSHPTIGASAGVFG
LLVSYAMLFPTRRVMLLFPPIPMPAWVFATAYGLIELFLGVSGTEADVAHFAHIGGMLGA
IALLLYWARNHRRSWTD