Protein Info for AO353_19955 in Pseudomonas fluorescens FW300-N2E3

Annotation: pyruvate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF02779: Transket_pyr" amino acids 6 to 178 (173 residues), 125.6 bits, see alignment E=1.8e-40 PF02780: Transketolase_C" amino acids 195 to 315 (121 residues), 127.3 bits, see alignment E=3.4e-41

Best Hits

Swiss-Prot: 44% identical to ODPB_CYAM1: Pyruvate dehydrogenase E1 component subunit beta (pdhB) from Cyanidioschyzon merolae (strain 10D)

KEGG orthology group: K00162, pyruvate dehydrogenase E1 component subunit beta [EC: 1.2.4.1] (inferred from 82% identity to avn:Avin_46160)

MetaCyc: 38% identical to acetoin:DCPIP oxidoreductase beta subunit (Syntrophotalea carbinolica DSM 2380)
RXN-9718 [EC: 2.3.1.190]

Predicted SEED Role

"Pyruvate dehydrogenase E1 component beta subunit (EC 1.2.4.1)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.4.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.1

Use Curated BLAST to search for 1.2.4.1 or 2.3.1.190

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W8C7 at UniProt or InterPro

Protein Sequence (326 amino acids)

>AO353_19955 pyruvate dehydrogenase (Pseudomonas fluorescens FW300-N2E3)
MSPRTTYREALREALREALQRDPRVFLMGEDVGRYGGSYAVSLGLLEAFGPERIRDAPLS
ELGFVGAGIGAALGGMRPIVEIMTVNFSLLALDPLMNTAAALRHMSGGQFSVPLVVRMAT
GAGRQLAAQHSHSLEGWYAHIPGLKILAPATVEDARGMLWPALLDPDPVLIFEHAQLYSL
EGETGEWQTLDISSAKVRRAGKDLTLIAYGGTLGKALAAAEQLAGEGIDCEVIDLRVLRP
LDDQTIMASVCKTRRALVVDEGWRSGSLSAEIITRIVEQGFFELDAPPSRVCSAEVPIPY
PRHLEEAALPQVSTIVAAARELCQAT