Protein Info for AO353_19935 in Pseudomonas fluorescens FW300-N2E3

Annotation: molecular chaperone GroEL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 TIGR02348: chaperonin GroL" amino acids 5 to 528 (524 residues), 717.6 bits, see alignment E=4e-220 PF00118: Cpn60_TCP1" amino acids 23 to 524 (502 residues), 250.6 bits, see alignment E=1.6e-78

Best Hits

Swiss-Prot: 72% identical to CH605_BRADU: 60 kDa chaperonin 5 (groL5) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: None (inferred from 75% identity to avn:Avin_25780)

MetaCyc: 49% identical to chaperonin GroEL (Escherichia coli K-12 substr. MG1655)
Non-chaperonin molecular chaperone ATPase. [EC: 3.6.4.10, 5.6.1.7]

Predicted SEED Role

"Heat shock protein 60 family chaperone GroEL" in subsystem GroEL GroES or Staphylococcal pathogenicity islands SaPI

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.4.10 or 5.6.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WMX4 at UniProt or InterPro

Protein Sequence (538 amino acids)

>AO353_19935 molecular chaperone GroEL (Pseudomonas fluorescens FW300-N2E3)
MAHSKILFRAAAREKILCGATQLADAVRVTLGPKSKSVLIQNKWGNPTVCNDGVTIAKRI
DLQDPEEGLGAQMLRQAAERTGDAVGDGTSTATVLAHAILADGIRNVVAGASAIDLKRGL
DRGLLLVVQSLAAQSRPVSTPKEKAQVATLSAHNDAVIGQLVADALEKVGVEGVVSVEES
KTTETVVEVMEGMRFDRGYVSPYFVTDTEKMQVELDDAYLLLCDHKIGALKDLLPLLELI
AKSGQPLVLIADDIEGEALTTLVVNQIRGVLRAVAIKAPGFGDRRKEMLQDIAVLTGATV
VSNELGISLEQVDLSQLGRAHRVVVQKDSTALIGGAGQREAIEARLQQIRVQMDATTSDY
DREKLQERLARLSGGVAVIRVGAPSEAEMKARKDALDDAISATRAAIAEGIVPGGGLALL
KAVPIIAAEEAGYEGDAKTGLQILRRALEAPARVIAENSAVDAGVVVARMLAEPGNIGFD
ASANVYVDMYEAGIIDPTKVVRIALENAVSVASILLLTEATMTDIPEKETPAQPPFPE