Protein Info for AO353_19920 in Pseudomonas fluorescens FW300-N2E3

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 258 to 281 (24 residues), see Phobius details amino acids 301 to 329 (29 residues), see Phobius details amino acids 341 to 365 (25 residues), see Phobius details PF02687: FtsX" amino acids 261 to 374 (114 residues), 39.9 bits, see alignment E=1.9e-14

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 73% identity to hse:Hsero_2389)

Predicted SEED Role

"ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WKV2 at UniProt or InterPro

Protein Sequence (380 amino acids)

>AO353_19920 ABC transporter permease (Pseudomonas fluorescens FW300-N2E3)
MKYSGILRIGFKLLVNDKAKFSALLVGITFSVFLMLQMTALFAGILNRAHSTVTNIGAAM
WIMDPAVNTPTIVIPLPDYLLDAVRSMEQVRYAVPVFIGGAQVRLASGTYQAVSVIGLDD
TSLFGRPELEEGSIEDIYAENAFIMVHDAEFSKLENPRIGTSFELNDHRGTIVAIAKVLT
SGLTGIPTLYTTYRRAIEYIPTTRFTVSYILLEPRNKAAEAGIKQQVAQLGYVALTRGEF
NQRITDFYIYQTGVGTNILTMTVISFLVGLSISGQTFYTFILENLDKFAALKAIGAKGRE
LIYMILFMATFTCLTGYGLGVGLVTLMIFTVRTYLPNYAAMITFWNLGLAFGLVLLIAGV
SSYVGIRKVLKIEPFDIFRG