Protein Info for AO353_19800 in Pseudomonas fluorescens FW300-N2E3

Annotation: protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01136: Peptidase_U32
  • amino acids 79 to 338 (260 residues), 293.1 bits, E=1.3e-91
• PF16325: Peptidase_U32_C
  • amino acids 355 to 436 (82 residues), 69.6 bits, E=2.1e-23

Best Hits

Swiss-Prot: 73% identical to YEGQ_ECOLI: Uncharacterized protease YegQ (yegQ) from Escherichia coli (strain K12)

KEGG orthology group: K08303, putative protease [EC: 3.4.-.-] (inferred from 93% identity to pfo:Pfl01_3718)

Predicted SEED Role

"Putative protease"

KEGG Metabolic Maps

• Biotin metabolism
• Lysine degradation
• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

See A0A0N9WYC4 at UniProt or InterPro

Protein Sequence (441 amino acids)

>AO353_19800 protease (Pseudomonas fluorescens FW300-N2E3)
MPLATPELLAPAGTLKNMRYAFAYGADAVYAGQPRYSLRVRNNEFDHANLALGIREAQAQ
GKRFYVVVNIAPHNAKLKTFLKDLEPVIAMAPDALIMSDPGLIMLVRRHFPQMPIHLSVQ
ANTVNWASVEFWQQQGLSRIILSRELSLEEIAEIRQQVPAMELEVFVHGALCMAYSGRCL
LSGYMNKRDANQGTCTNACRWKYSAQPATENVVGEIVQAFIPEPTLGIGTPTDQVFLLQE
ANRPDELMPAFEDEHGTYIMNAKDLRAVQHVARLTQMGVHSLKIEGRTKSHFYCARTTQV
YRRAIDDAVAGREFDRSLMTDLESLAQRGYTEGFLRRHVHDEYQNYQNGSSVSERQQFVG
ELTGERRDRLAEVKVKNRFGLGDHMELMTPKGNFHFDLHQLQSAKGEAIEVAPGDGHTVY
LPIPDAVDLKFGLLMRDVRGD