Protein Info for AO353_19790 in Pseudomonas fluorescens FW300-N2E3

Annotation: sodium:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 53 to 73 (21 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 146 to 171 (26 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details amino acids 259 to 278 (20 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details amino acids 331 to 350 (20 residues), see Phobius details amino acids 357 to 386 (30 residues), see Phobius details amino acids 421 to 438 (18 residues), see Phobius details PF13726: Na_H_antiport_2" amino acids 3 to 86 (84 residues), 104.1 bits, see alignment E=5.3e-34 PF03553: Na_H_antiporter" amino acids 150 to 433 (284 residues), 277.3 bits, see alignment E=2.4e-86 PF06808: DctM" amino acids 189 to 389 (201 residues), 35.6 bits, see alignment E=7.5e-13

Best Hits

Swiss-Prot: 59% identical to Y2115_VIBPA: Uncharacterized membrane protein VP2115 (VP2115) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K07084, (no description) (inferred from 92% identity to pfo:Pfl01_3769)

Predicted SEED Role

"Histidine permease YuiF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WLM8 at UniProt or InterPro

Protein Sequence (439 amino acids)

>AO353_19790 sodium:proton antiporter (Pseudomonas fluorescens FW300-N2E3)
MINAVIAAVGIMLVLSLSRVHVVIALIVGALVGGLTGGLGIDATLKAFNSGLGGGATVAL
SYALLGAFAVAIAKSGLAHALADKALLLVDRQDAAGGGQVKWLLIALLWVVAIASQNVLP
IHIAFIPLLVPPLLYVLTKLQMDRRLIACVMTFGLITPYMFLPVGFGNIFLNEILLANVS
RSGVDISGVNVTHAMGIPALGMVFGLLMAFVSYRKKRVYDLEKIERVEQVAVQYNPLTLM
VAGLAIAAAFIIQLLLDSMIIGALAGFLIFSVSGVVRWRETDDLFTEGMKMMAMIGFIMI
AASGFAEVMKATGDVKTLVEASASWIGHSKGVGALLMLLVGLLVTMGIGSSFSTVPILAA
IFVPLCVQLGFSPLAIVCIVGTAGALGDAGSPASDSTLGPTSGLNIDGQHHHIWDTVVPT
FLHYNLPLLAFGWVAAMIL