Protein Info for AO353_19780 in Pseudomonas fluorescens FW300-N2E3

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 signal peptide" amino acids 10 to 11 (2 residues), see Phobius details transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details PF02518: HATPase_c" amino acids 333 to 436 (104 residues), 71 bits, see alignment E=1.2e-23 PF14501: HATPase_c_5" amino acids 334 to 421 (88 residues), 23.7 bits, see alignment E=3.7e-09

Best Hits

KEGG orthology group: None (inferred from 88% identity to pfo:Pfl01_3771)

Predicted SEED Role

"Sensor protein PhoQ (EC 2.7.13.3)" in subsystem Lipid A modifications (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VWV9 at UniProt or InterPro

Protein Sequence (437 amino acids)

>AO353_19780 histidine kinase (Pseudomonas fluorescens FW300-N2E3)
VRSIQRRLSLGLISVMVVVGLVLAQTSLWLFEVGLQRYLEAGLRNDSESLLMALVRGPLG
LQLDERRLSPAYQRPFSGHYFHIDFADNHWRSRSLWDQELPLLDHPGLHSNLQLGPEGQQ
LLVLRADYRRLGQSISISVAQDYTPVRESFQRMRQVGLGLGLTGLLLILVLQRVTVRRAL
RPLENAREQIAQLQQGQRSQLDDQVPLELVPLVAQINHLLAHTEDSLKRSRNALGNLGHA
LKTPLAVLLSLASGEKLDAHPELRKILREQLAQVQQRLNRELNRARLAGDALPGAQFDCA
AELPGLLATLNMIHGDHLNLDYTAPSGLHLPWDREDLLELLGNLLDNACKWADAEVRLSI
VETAEGFVLAVEDDGPGIPEAQRDQVFSRGTRLDEQTDGHGLGLGIARDIVEAWGGELVL
QESEWGGLKVVVELPRR