Protein Info for AO353_19745 in Pseudomonas fluorescens FW300-N2E3

Annotation: Rieske (2Fe-2S) protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 transmembrane" amino acids 225 to 246 (22 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details PF00355: Rieske" amino acids 64 to 132 (69 residues), 61.9 bits, see alignment E=4.3e-21 PF00848: Ring_hydroxyl_A" amino acids 189 to 377 (189 residues), 99.3 bits, see alignment E=3.1e-32

Best Hits

KEGG orthology group: None (inferred from 52% identity to bam:Bamb_6236)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (378 amino acids)

>AO353_19745 Rieske (2Fe-2S) protein (Pseudomonas fluorescens FW300-N2E3)
MDHQTQVSLSRKIFSLIDERGTSMADSVSLNPVSSYTCTQQLEREQRALFRARPLLMGLS
CRLVHPGDYLTDDLSGVPIVVVRTAEGRLSALINVCRHRGAKLLEGTGRLASSLSCPYHG
WTYDLHGKLVQLAPSGGFDGLERTERNLVALSVVERNGLIWVHPTPGMTINIDARWGALN
DELAGYDFQRFAHYETRLLHRSFNWKIVIDTFLENWHFPFVHRATVLSIFLPAISQFEAF
GLNARLIMPRRSILQMRDGPEERWNLLKHSLVIYLLFPNTLLLWQGDHLEIWRAFPSRSG
AVDQCVAEVSLYTPRAATTERERKFWDKNMALLIDTVDGEDFKLSEHLQKGFTSGAQEHL
TFGKNEPALQHFHRSIQA