Protein Info for AO353_19575 in Pseudomonas fluorescens FW300-N2E3

Annotation: dimethylglycine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01965: DJ-1_PfpI
  • amino acids 5 to 164 (160 residues), 107.3 bits, E=3.7e-35

Best Hits

Swiss-Prot: 83% identical to INHA_PSEPU: Isonitrile hydratase (inhA) from Pseudomonas putida

KEGG orthology group: None (inferred from 82% identity to pba:PSEBR_a3931)

MetaCyc: 83% identical to isocyanide hydratase subunit (Pseudomonas putida N19-2)
Cyclohexyl-isocyanide hydratase. [EC: 4.2.1.103]

Predicted SEED Role

"ThiJ/PfpI family protein"

KEGG Metabolic Maps

• Caprolactam degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.103

Sequence Analysis Tools

See A0A0N7H0H7 at UniProt or InterPro

Protein Sequence (226 amino acids)

>AO353_19575 dimethylglycine dehydrogenase (Pseudomonas fluorescens FW300-N2E3)
MTLQIGFLLFPQVQQLDLTGPYDVLASLPDVKVHLIWKDLVPVTASTGLVLKPTTTFDDC
PDLDVICIPGGSGVGPLMEDPQTLAFIRKHAAQARYVTSVCTGALVLGAAGLLKGKRATT
HWAYHELLSLLGAIPVRDRVVRDGNLLTGGGITAGIDFALTLAAELYDKDTAQLVQLQLE
YAPAPPFNSGDPQTAPKAVLEEAYRRAASSLNQRTLITERVAARLG