Protein Info for AO353_19565 in Pseudomonas fluorescens FW300-N2E3

Annotation: vanillate O-demethylase oxidoreductase VanB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF08327: AHSA1" amino acids 14 to 149 (136 residues), 51.3 bits, see alignment E=7.1e-18

Best Hits

KEGG orthology group: None (inferred from 86% identity to pba:PSEBR_a3935)

Predicted SEED Role

"Aha1 domain superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WMS5 at UniProt or InterPro

Protein Sequence (152 amino acids)

>AO353_19565 vanillate O-demethylase oxidoreductase VanB (Pseudomonas fluorescens FW300-N2E3)
MHSSDRIERKILLKAPRSTVWRALANAESFGKWFGVALEGKRFVAGERTQGQITYPGYEH
LVWDVQVARVEPERVFAFRWHPYAVEPGMDYSSEPTTLVLFELEDMDGGTLLKVVESGFD
NIPAERRLKAFRMNSRGWDEQMTNIETYLATP