Protein Info for AO353_19500 in Pseudomonas fluorescens FW300-N2E3

Annotation: peptidase S8 and S53 subtilisin kexin sedolisin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF00082: Peptidase_S8" amino acids 55 to 145 (91 residues), 26.4 bits, see alignment E=2.2e-10

Best Hits

KEGG orthology group: None (inferred from 68% identity to pfl:PFL_4133)

Predicted SEED Role

"Extracellular protease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WMR4 at UniProt or InterPro

Protein Sequence (225 amino acids)

>AO353_19500 peptidase S8 and S53 subtilisin kexin sedolisin (Pseudomonas fluorescens FW300-N2E3)
MKLELRIGVVDSGHSVAQRGQVSSGRRFYLVEDGLAEDELRDDPLGHGSAVVEAISRRAA
SARFCVAQVFDQRGVTSALQIATAIDWLVTQDVRVINLSLGLRQDRNLLREACSAALARG
VLLCASSPAQGEGVYPASYPQVLRVTGDARCGEHEWSWLNSQQADFAACVQGMYPGQSGA
SLGCAALTGHIANFLAGHLDASNAQVLEWLRDNARYRGPERRVWE