Protein Info for AO353_19490 in Pseudomonas fluorescens FW300-N2E3

Annotation: Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 634 PF01590: GAF" amino acids 117 to 208 (92 residues), 35.5 bits, see alignment E=4.1e-12 PF00158: Sigma54_activat" amino acids 335 to 501 (167 residues), 214.8 bits, see alignment E=2e-67 PF14532: Sigma54_activ_2" amino acids 353 to 506 (154 residues), 69.8 bits, see alignment E=8.8e-23 PF07728: AAA_5" amino acids 357 to 468 (112 residues), 30.2 bits, see alignment E=1.3e-10 PF02954: HTH_8" amino acids 592 to 632 (41 residues), 45.2 bits, see alignment 1.9e-15

Best Hits

KEGG orthology group: None (inferred from 83% identity to pfl:PFL_4135)

Predicted SEED Role

"sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WY73 at UniProt or InterPro

Protein Sequence (634 amino acids)

>AO353_19490 Fis family transcriptional regulator (Pseudomonas fluorescens FW300-N2E3)
MTLIKTITPQPQHEARLAREKLHLEGEVPNGVLRAEIDASWRRSLSHGVHFNGKHELALE
SSASLEVLLASNRLLIDAAMPAIDYLAERQGKEGLIILANSEATILAVEGRADRLKGSGL
QDITLGACWSEAARGTNALGTALVEARPTLIDCGEHYLDRLSDFSCSSVPIHCPQGDILG
VLDLTREGPLGRAHDSTALLAMAVSQIESRVFNASFPEQIVLAFHSRRQYLESPWQGLLA
VSLGGQILAVSTQACQLLNAERSALVGHRCEEFLGVDGLQLLARLQQGGIGSLQTAKGEF
FYKTLRAPQRSINVTSTPRSVAKNPKPQLDLESLAGSNARYARALRMARQGLANELPVLL
LGETGTGKEVIARALHMAGSRCDKPFVAVNCAAIPEGLIESELFGYREGAFTGSRRGGMI
GRLQQAHGGTLFLDEIGDMPLALQARLLRVLQDRKVAPLGAGEEQDIDVALICATHRDLK
RLVEEKHFREDLFYRVNGISVMLPALRERDDFSELVTRLLDKLDAPTVKLKGELSNLLAG
YHWPGNIRQLEMVLRTALAMREPGETVLSLEHLPDSMLDELNACERSTCGSIRENELELI
RQSLDNHHGNVSATADALGISRATLYRKLKQLRN