Protein Info for AO353_19365 in Pseudomonas fluorescens FW300-N2E3

Annotation: thiol:disulfide interchange protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 578 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 162 to 191 (30 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details amino acids 281 to 311 (31 residues), see Phobius details amino acids 318 to 342 (25 residues), see Phobius details amino acids 354 to 373 (20 residues), see Phobius details amino acids 379 to 397 (19 residues), see Phobius details amino acids 409 to 430 (22 residues), see Phobius details PF11412: DsbD_N" amino acids 27 to 134 (108 residues), 89.9 bits, see alignment E=3.2e-29 PF13386: DsbD_2" amino acids 167 to 356 (190 residues), 28 bits, see alignment E=4.9e-10 PF02683: DsbD" amino acids 168 to 346 (179 residues), 43.2 bits, see alignment E=1.1e-14 PF13899: Thioredoxin_7" amino acids 469 to 538 (70 residues), 44.1 bits, see alignment E=4.8e-15

Best Hits

Swiss-Prot: 69% identical to DSBD2_PSEAE: Thiol:disulfide interchange protein DsbD 2 (dsbD2) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K04084, thiol:disulfide interchange protein DsbD [EC: 1.8.1.8] (inferred from 80% identity to pba:PSEBR_a1671)

Predicted SEED Role

"Cytochrome c-type biogenesis protein DsbD, protein-disulfide reductase (EC 1.8.1.8)" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange (EC 1.8.1.8)

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.8

Use Curated BLAST to search for 1.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VRU4 at UniProt or InterPro

Protein Sequence (578 amino acids)

>AO353_19365 thiol:disulfide interchange protein (Pseudomonas fluorescens FW300-N2E3)
MRRLFLLFFLFIAGLAQAASNPFDTKADFLPVGKAFVFTSERLESGETQLFWQIADGYYL
YQQRMKFDGLPEADKPPLPLGEAHSDEFFGDQQVYRQGLELKVPAGASGQIKVGFQGCAD
AGLCYPPQTQVIDLGGSTAAVNAAQAPDEALASGLQQRALGWSLLVFFGLGLLLAFAPCS
LPMLPILAGLIVGSGASPKRGFALAGSYVVSMALVYAVLGVVAALLGANLQALLQNVWLL
GSFAVVFVLLSLPMFGFFELQLPVALRDRLENASRKQGGGSLIGAGVLGALSGLLVGPCM
TAPLAGALLYIAQSGNALHGGLILFAMGIGIGLPLLLLVTVGNRFLPKPGTWMNLLKGIF
GFLFLGTALVMVRPVLDESLWIGLWGALLLIIAYSAWRQTGGFGRAAHVFGGMALLSGLW
GSLLLIGAAGGSDDLFNPLQVYSAQASTRVAGPTADDAFITVKDPAALQHELDTARAQGQ
WVLLDYYADWCVSCKIMEKQVFGKPQVMDALKDVRLLRLDVTADNAASRELLGRYKVPGP
PSLLWIGTDGIERRSQRITGEVDAAGFLQRWNMTRDAR