Protein Info for AO353_19360 in Pseudomonas fluorescens FW300-N2E3

Annotation: peroxiredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 42 to 65 (24 residues), see Phobius details amino acids 80 to 97 (18 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details PF01790: LGT" amino acids 3 to 99 (97 residues), 40.9 bits, see alignment E=3e-14 PF08534: Redoxin" amino acids 132 to 254 (123 residues), 61.9 bits, see alignment E=1.3e-20 PF00578: AhpC-TSA" amino acids 133 to 244 (112 residues), 55.4 bits, see alignment E=1.2e-18

Best Hits

KEGG orthology group: None (inferred from 84% identity to pfl:PFL_4183)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WMP9 at UniProt or InterPro

Protein Sequence (288 amino acids)

>AO353_19360 peroxiredoxin (Pseudomonas fluorescens FW300-N2E3)
MLTFTLGTFAIALNHLLLISALALATLVGWRVAKRGGENPESVLFSLFLLGLLAARVGFV
LTYWAHYRDDPWQIIDLRDGGFLAWPGVIALLLATLLRGWRRPALRKPLGAGVGSGLLFW
LLASLSLNLYEQGTRLPDIVLRNAAGETVQLADYQGGPLVINLWATWCPPCRREMPVLEN
AQQHRPDLTFLFVNQAESMQSVSTFLATQGLSLSNVLFDGGGRLSQAVGSMALPTTLFYS
AEGRMLGSHLGELSEASLARALENFDSPTSAIQATPSRKLPCPASATC