Protein Info for AO353_19285 in Pseudomonas fluorescens FW300-N2E3

Annotation: chemotaxis protein CheW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 PF01584: CheW" amino acids 21 to 155 (135 residues), 126.9 bits, see alignment E=4.4e-41 PF00072: Response_reg" amino acids 181 to 300 (120 residues), 50 bits, see alignment E=3.1e-17

Best Hits

KEGG orthology group: K03415, two-component system, chemotaxis family, response regulator CheV (inferred from 99% identity to pfo:Pfl01_3954)

Predicted SEED Role

"Chemotaxis protein CheV (EC 2.7.3.-)" in subsystem Bacterial Chemotaxis or Flagellar motility (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WKL2 at UniProt or InterPro

Protein Sequence (311 amino acids)

>AO353_19285 chemotaxis protein CheW (Pseudomonas fluorescens FW300-N2E3)
MAGILDTVDQRTQLVGENRLEILMFRLAGRQLFAINVFKVQEVLQLPKLTLMPQRHPFVC
GVVNLRGQTLPVIDLSQAIGMRPLVPGPNSTIIVTEYNRSVQAFLVGGVDRIVNMNWEAI
LPPPTSAGRQHYLTAISKVDDQLVEIIDVEKVLAEIVPYNAKVSRDKLEDPVLERARGRE
VLLVDDSNVALSQLRDTLGQLGVKMHIASDGLKALNMLKAWADTGVVMTDKLLMIFTDAE
MPEMDGYRLTTEIRNDPRLRGLYVVLHTSLSGSFNDSMVKKVGCDNFLSKFQPDKLVDVV
RQRLMLDAVPA