Protein Info for AO353_18810 in Pseudomonas fluorescens FW300-N2E3
Annotation: flagellar motor protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 32% identical to MOTA_HELPJ: Motility protein A (motA) from Helicobacter pylori (strain J99 / ATCC 700824)
KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 97% identity to pba:PSEBR_a1503)Predicted SEED Role
"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0N9WL87 at UniProt or InterPro
Protein Sequence (246 amino acids)
>AO353_18810 flagellar motor protein (Pseudomonas fluorescens FW300-N2E3) MDVLSLIGIIMAFIAIIGGNYLEGGHLGALANGPAALIVLGGTIGAALLQSPMSAFKRAM QILRWILFPPRVDLAGGIDRVVNWSLTARKEGLLGLEGVADSEPDSYSRKGLQLLVDGAE PESIRSILEVDFYTQESRDIEAAKVFESMGGYAPTIGIIGAVMGLIHVMGNLGDPSQLGS GIAVAFVATIYGVASANLVLLPIASKLKSIALRQSRYREMLLEGILSIAEGENPRSIELK LQGFMD