Protein Info for AO353_18760 in Pseudomonas fluorescens FW300-N2E3

Annotation: flagellar biosynthetic protein FlhB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 transmembrane" amino acids 35 to 57 (23 residues), see Phobius details amino acids 89 to 118 (30 residues), see Phobius details amino acids 139 to 164 (26 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details TIGR00328: flagellar biosynthetic protein FlhB" amino acids 8 to 354 (347 residues), 392.6 bits, see alignment E=8.3e-122 PF01312: Bac_export_2" amino acids 8 to 348 (341 residues), 416.8 bits, see alignment E=3.7e-129

Best Hits

KEGG orthology group: K02401, flagellar biosynthetic protein FlhB (inferred from 92% identity to pfl:PFL_1654)

Predicted SEED Role

"Flagellar biosynthesis protein FlhB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H0F8 at UniProt or InterPro

Protein Sequence (379 amino acids)

>AO353_18760 flagellar biosynthetic protein FlhB (Pseudomonas fluorescens FW300-N2E3)
MAESESGQDKTEDPTDKRKKDSREKGEIARSKELNTLAVMLAGAGGLLIYGGGLALDLLE
IMRLNFSLPREVVLTPDAMGLYLLKSGKIAIIAVQPVLLTLLLAAIIGPISLGGWLFAGS
SLAPKFSRMNPANGLKRMFSSTALIELLKALAKFLLVLFVALSVLRSDIDDLLRIAHEPL
EQAIIHSVQLVGWSTLWMACGLILIAAVDVPVQLYQSHKKLLMTKQEVRDEHKDQEGRPE
VKQRIRQLQREMSQRRMMAAIPEADVVITNPTHYAVALKYDPEKGGAPMLVAKGSDFLAL
KIREIAVANEVLLLESPALARSIYYSTELDQEIPGGLYLAVAQVLAYVYQIRQYRAGKGK
RPDPLKDELPIPPDLRRDS