Protein Info for AO353_18755 in Pseudomonas fluorescens FW300-N2E3

Annotation: flagellar biosynthetic protein FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 13 to 35 (23 residues), see Phobius details amino acids 44 to 61 (18 residues), see Phobius details amino acids 76 to 105 (30 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 179 to 203 (25 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details TIGR01400: flagellar biosynthetic protein FliR" amino acids 15 to 256 (242 residues), 253.7 bits, see alignment E=9.3e-80 PF01311: Bac_export_1" amino acids 16 to 246 (231 residues), 223.6 bits, see alignment E=1.3e-70

Best Hits

Swiss-Prot: 40% identical to FLIR_SALTY: Flagellar biosynthetic protein FliR (fliR) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 86% identity to pba:PSEBR_a1493)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WKC0 at UniProt or InterPro

Protein Sequence (260 amino acids)

>AO353_18755 flagellar biosynthetic protein FliR (Pseudomonas fluorescens FW300-N2E3)
MSLLALTDAQISTWVASFMLPLFRVGAVLTTMPVFGTTLVPKRIRLYFALAITVVITPGL
PPMPQVNPLDLSGLLLIAEQILIGALLGFSLQLFFQAFVVAGQIVSIQMGMGFASMVDPT
NGVSAAVIGQFLTMLVTLLFLGMNGHLVVFEVLTESFTTLPVGSGMLVNHFWEMAGKMGW
VLGAAMLLVLPAITALLVVNIAFGVMTRAAPQLNIFSIGFPLTLVLGLVIFWVSLGDILN
QYQPLATEALQLLRDMAQAR