Protein Info for AO353_18740 in Pseudomonas fluorescens FW300-N2E3

Annotation: flagellar assembly protein FliO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 39 to 58 (20 residues), see Phobius details TIGR03500: flagellar biosynthetic protein FliO" amino acids 44 to 112 (69 residues), 76.3 bits, see alignment E=7.2e-26 PF04347: FliO" amino acids 56 to 136 (81 residues), 76.7 bits, see alignment E=6.3e-26

Best Hits

Swiss-Prot: 67% identical to FLIO_PSEAE: Flagellar protein FliO (fliO) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02418, flagellar protein FliO/FliZ (inferred from 86% identity to pfl:PFL_1650)

Predicted SEED Role

"Flagellar biosynthesis protein FliQ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WIH2 at UniProt or InterPro

Protein Sequence (143 amino acids)

>AO353_18740 flagellar assembly protein FliO (Pseudomonas fluorescens FW300-N2E3)
VKAFLGVLLALPLSAWAAEPVAAAATPAVGSGVAGQLTQLVLGLLMVLGLIFFLAWLLRR
VQQAGPAGKGQVIELIGSRALGPRDRLVLVQVGNEQILLGLTPGTITPLHVLKEPVQVPS
TEQATPEFAQRLMELLGKDKDKK