Protein Info for AO353_18675 in Pseudomonas fluorescens FW300-N2E3

Annotation: flagellar hook-basal body protein FliE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 PF02049: FliE" amino acids 26 to 109 (84 residues), 107.6 bits, see alignment E=1.4e-35 TIGR00205: flagellar hook-basal body complex protein FliE" amino acids 34 to 108 (75 residues), 89 bits, see alignment E=1.3e-29

Best Hits

Swiss-Prot: 88% identical to FLIE_PSEFS: Flagellar hook-basal body complex protein FliE (fliE) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K02408, flagellar hook-basal body complex protein FliE (inferred from 94% identity to pba:PSEBR_a1477)

Predicted SEED Role

"Flagellar hook-basal body complex protein FliE" in subsystem Flagellum or Flagellum in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H0F6 at UniProt or InterPro

Protein Sequence (109 amino acids)

>AO353_18675 flagellar hook-basal body protein FliE (Pseudomonas fluorescens FW300-N2E3)
MSQGIEFNRLMLDMRSMQMDAMAQPKAAVAVPEMGGSSFSDMLGQAVNKVNDTQQASNQL
ANAFEIGKSGVDLTDVMISSQKASVSFQALTQVRNKLVQAYQDIMQMPV