Protein Info for AO353_18670 in Pseudomonas fluorescens FW300-N2E3

Annotation: Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 PF00072: Response_reg" amino acids 5 to 114 (110 residues), 93.9 bits, see alignment E=2.1e-30 PF00158: Sigma54_activat" amino acids 135 to 296 (162 residues), 236 bits, see alignment E=5.9e-74 PF14532: Sigma54_activ_2" amino acids 142 to 296 (155 residues), 71.3 bits, see alignment E=3.1e-23 PF07728: AAA_5" amino acids 154 to 272 (119 residues), 32.4 bits, see alignment E=2.5e-11 PF00004: AAA" amino acids 154 to 273 (120 residues), 21.6 bits, see alignment E=7.7e-08 PF02954: HTH_8" amino acids 412 to 451 (40 residues), 50.4 bits, see alignment 4.4e-17

Best Hits

KEGG orthology group: K10943, two component system, response regulator FlrC (inferred from 91% identity to pba:PSEBR_a1476)

Predicted SEED Role

"Flagellar regulatory protein FleQ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W7X1 at UniProt or InterPro

Protein Sequence (466 amino acids)

>AO353_18670 Fis family transcriptional regulator (Pseudomonas fluorescens FW300-N2E3)
MAIKVLLVEDDRSLREALTDTLLLAGHDYTAVGSAEDALQAVASESFNLVVSDVNMPGMD
GHQLLGLLRIRQPQLPVLLMTAHGAVERAVDAMRQGAADYLVKPFEPKALLDLVARHALG
CLGAAEGEGPVAFEPASAQLLELAARVARSDSTVLISGESGTGKEVLARYIHQHSRRASQ
PFIAINCAAIPDNMLEATLFGHEKGSFTGAIAAQAGKFEQADGGTILLDEISEMPLGLQA
KLLRVLQEREVERVGARKPIALDIRVVATTNRDLAGEVAAGRFREDLYYRLSVFPLAWRP
LRERTADILPLAERLLAKHVNKMKHAAARLSPEAQACLIGYPWPGNVRELDNAIQRALIL
QQGGLIQPQDFCLAGPVACAPLPALTPAPMSSRMLEVEAPQGDSAGALGDDLRRREFQMI
IDTLRSERGRRKEAAERLGISPRTLRYKLAQMRDAGMDVEGYLFAT