Protein Info for AO353_18590 in Pseudomonas fluorescens FW300-N2E3

Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 PF01842: ACT" amino acids 2 to 38 (37 residues), 27.1 bits, see alignment 7e-10 PF00158: Sigma54_activat" amino acids 208 to 374 (167 residues), 201.5 bits, see alignment E=1.9e-63 PF14532: Sigma54_activ_2" amino acids 211 to 379 (169 residues), 61.6 bits, see alignment E=2.6e-20 PF18024: HTH_50" amino acids 466 to 514 (49 residues), 60.8 bits, see alignment 2.1e-20 TIGR04381: TyrR family helix-turn-helix domain" amino acids 469 to 516 (48 residues), 85.5 bits, see alignment 9.5e-29

Best Hits

KEGG orthology group: K03721, transcriptional regulator of aroF, aroG, tyrA and aromatic amino acid transport (inferred from 98% identity to pba:PSEBR_a1451)

Predicted SEED Role

"Phenylalanine hydroxylase transcriptional activator PhhR" in subsystem Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WSF1 at UniProt or InterPro

Protein Sequence (520 amino acids)

>AO353_18590 AAA family ATPase (Pseudomonas fluorescens FW300-N2E3)
MRIKVHCQNRIGILRDILNLLVEYGINVARGEVGGEHGNAIYLHCPNLINLQFQALRPKF
EAITGVFGVKRVGLMPSERRHMELNALLGALEFPVLSIDMGGSIVAANRAAAQLLGVRVD
EVPGIPLSRYAEDFDLPELVRANKSRINGLRVKVKGDVFLADIAPLQSEHDDSEAMAGAV
LTLHRADRVGERIYNVRKQELRGFDSIFQSSKVMAAVVREARRMAPLDAPLLIEGETGTG
KELLARACHLASPRGQSPLMALNCAGLPESMAETELFGYGPGAFEGARAEGKLGLLELTA
GGTLFLDGVGEMSPRLQVKLLRFLQDGCFRRVGSDEEVYLDVRVICATQVDLSELCASGE
FRQDLYHRLNVLSLHIPPLRECLDGLTPLVEHFLDQASRQIGCPLPKLAPAAMERLSHYH
WPGNVRQLENVLFQAVSLCDGGTVKAEHIRLPDYGVRQPLGDFSLEGGLDEIVGRFEKAV
LEQLYSEYPSSRLLGKRLGVSHTTIANKLREYEVGKEPGA