Protein Info for AO353_18530 in Pseudomonas fluorescens FW300-N2E3
Annotation: chromosome segregation protein ScpA
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 60% identical to SCPA_XYLFT: Segregation and condensation protein A (scpA) from Xylella fastidiosa (strain Temecula1 / ATCC 700964)
KEGG orthology group: K05896, segregation and condensation protein A (inferred from 94% identity to pfo:Pfl01_1489)Predicted SEED Role
"Segregation and condensation protein A" in subsystem Two cell division clusters relating to chromosome partitioning
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0N9WMC4 at UniProt or InterPro
Protein Sequence (272 amino acids)
>AO353_18530 chromosome segregation protein ScpA (Pseudomonas fluorescens FW300-N2E3) MSAVEPVDSQTGAQQELPFAMVYGQAVMEMPLDLYIPPDALEVFLEAFEGPLDLLLYLIR KQNINILDIPVAEITRQYMGYVELMQSVRLELAAEYLVMAAMLAEIKSRMLLPRSAEIEE EEDDPRAELIRRLQEYERFKAAAEGIDGLSRVGRDVVVPKLDAPQAMARKLLPDVSLEEL LMSMAEVLRRGDMFESHQVSREALSTRERMSDVLERLKGGGFVPFVELFTAEEGRLGVVV TFMAILELVKESLVELVQNEPFAAIHVRARAE