Protein Info for AO353_18515 in Pseudomonas fluorescens FW300-N2E3

Annotation: septation protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 transmembrane" amino acids 7 to 22 (16 residues), see Phobius details amino acids 35 to 54 (20 residues), see Phobius details amino acids 66 to 83 (18 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details TIGR00997: intracellular septation protein A" amino acids 1 to 188 (188 residues), 172.8 bits, see alignment E=4.1e-55 PF04279: IspA" amino acids 1 to 187 (187 residues), 200.4 bits, see alignment E=1.4e-63

Best Hits

Swiss-Prot: 91% identical to YCIB_PSEPF: Probable intracellular septation protein A (Pfl01_1486) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K06190, intracellular septation protein (inferred from 91% identity to pfo:Pfl01_1486)

Predicted SEED Role

"Intracellular septation protein IspA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WXT0 at UniProt or InterPro

Protein Sequence (198 amino acids)

>AO353_18515 septation protein A (Pseudomonas fluorescens FW300-N2E3)
VKQFIDFIPLLLFFIVFKIDPRVVDIAGYPLTVGGIYSATAMLITSSLVVYGTLFIKQRK
LEKSQWLTLIACLVFGSLTLAFHSETFLKWKAPVVNWLFALAFIGSHFIGEQLLIKRIMG
HALTLPDLVWSRLNIAWIGFFLFCGAANLFVAFTFQDYWVDFKVFGSLGMTLLFLVGQGI
YLSRHLHDADTSTPKTED