Protein Info for AO353_18375 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details amino acids 277 to 299 (23 residues), see Phobius details PF00892: EamA" amino acids 14 to 142 (129 residues), 54.3 bits, see alignment E=8.5e-19 amino acids 158 to 294 (137 residues), 71 bits, see alignment E=5.6e-24

Best Hits

KEGG orthology group: None (inferred from 88% identity to pfo:Pfl01_1448)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WIB8 at UniProt or InterPro

Protein Sequence (309 amino acids)

>AO353_18375 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
VIATRRSADGFALQVMLGLCLIWGIQQVMIKWAAADIAPVMQAAARSGISALLVGLLICW
KGGWNQVGSTWRGGLLAGGLFATEFLFIAEGLKLTTAAHMSVFLYTAPIFTALGVHWLLP
SERLRRLQWLGILLAFIGIAVAFAGGVSWDNLDRRMLLGDAFGVLAGAAWGATTVVVRAS
RLSEAPATLTLFYQLIVGFLGLLLIAALSGQITHVHLTNVAVASVLFQGLVVSFFSYLTW
FWLLRRYLASNLAVFSFMTPLFGVTFGVLLLGEPLSVNFVVGAVLVLLGITFVSAEQWVR
RRLRTMLER