Protein Info for AO353_18290 in Pseudomonas fluorescens FW300-N2E3

Annotation: FMN-dependent NADH-azoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 PF03358: FMN_red" amino acids 3 to 169 (167 residues), 51.5 bits, see alignment E=8.6e-18 PF02525: Flavodoxin_2" amino acids 3 to 197 (195 residues), 197 bits, see alignment E=2.8e-62

Best Hits

Swiss-Prot: 92% identical to AZOR2_PSEPF: FMN-dependent NADH-azoreductase 2 (azoR2) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K01118, FMN-dependent NADH-azoreductase [EC: 1.7.-.-] (inferred from 91% identity to pba:PSEBR_a1407)

MetaCyc: 45% identical to FMN dependent NADH:quinone oxidoreductase (Escherichia coli K-12 substr. MG1655)
RXN0-5375 [EC: 1.7.1.17]; 1.6.5.- [EC: 1.7.1.17]

Predicted SEED Role

"FMN-dependent NADH-azoreductase"

Isozymes

Compare fitness of predicted isozymes for: 1.7.-.-

Use Curated BLAST to search for 1.7.-.- or 1.7.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WM90 at UniProt or InterPro

Protein Sequence (199 amino acids)

>AO353_18290 FMN-dependent NADH-azoreductase (Pseudomonas fluorescens FW300-N2E3)
MSRVLIIESSARQQDSVSRQLTQTFISQWKAAHPADQITVRDLATHPVPHLDANLLGGWM
KPAEQRNETEQSSLERSNQLTDELLAADVLVMAAPMYNFAIPSTLKAWLDHVLRAGVTFK
YTETGPQGLLSGKRAYVLTARGGIYAGSTSDHQEPYLRQVMAFIGIHDVTFIHAEGMNLG
GDFHEKGLNQANAKLAQVA