Protein Info for AO353_18085 in Pseudomonas fluorescens FW300-N2E3

Annotation: oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00174: Oxidored_molyb
  • amino acids 95 to 264 (170 residues), 165.9 bits, E=9.9e-53
• PF03404: Mo-co_dimer
  • amino acids 292 to 392 (101 residues), 40.7 bits, E=3.6e-14

Best Hits

KEGG orthology group: K07147, (no description) (inferred from 67% identity to pna:Pnap_2692)

MetaCyc: 60% identical to sulfite:cytochrome c oxidoreductase molybdenum subunit (Starkeya novella)
Sulfite dehydrogenase. [EC: 1.8.2.1]

Predicted SEED Role

"Twin-arginine translocation pathway signal"

MetaCyc Pathways

• superpathway of sulfide oxidation (Starkeya novella) (4/5 steps found)
• sulfite oxidation I (1/1 steps found)
• superpathway of sulfide oxidation (Acidithiobacillus ferrooxidans) (7/10 steps found)
• superpathway of sulfur metabolism (Desulfocapsa sulfoexigens) (2/6 steps found)
• superpathway of sulfur oxidation (Acidianus ambivalens) (1/9 steps found)

KEGG Metabolic Maps

• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.2.1

Sequence Analysis Tools

See A0A0N9VWQ2 at UniProt or InterPro

Protein Sequence (409 amino acids)

>AO353_18085 oxidase (Pseudomonas fluorescens FW300-N2E3)
MSIDNRNTIKRRVFLQGASLVAAGLAFKPLHSRAAETEAQDFSNGTRELVAYPQKRPLMR
VTARPPHLETPFSVFNESILTPNDAFFVRYHLANLPTSIDADNYQLQIKGLVDKPLSLSL
AELKALGKTVEVVAVNQCSGNSRGYGSPRVFGAQLGNGSVGNARWTGIPLKAVLEQAGVQ
AGAKQVTFRGLDHPVLPTTPEFIKALGIDLALSDEPMIAWAMNGTDIPFLNGYPIKLIVP
GYFGTYWVKHLSEIEVIDHTFEGYFMEKAYRVPDNDCQCVPPGTVPDKTRPIGRLKVRSF
ITSLQPGAKVKLNEPITLKGFAFDGGHGIQSVELSEDGGRNWQLAVLGENLGNYSFREWT
LQWVPREKGKVGLQVRATNGQGEQQPVRALWNPAIYVKNNIETTPITVV