Protein Info for AO353_18085 in Pseudomonas fluorescens FW300-N2E3

Annotation: oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF00174: Oxidored_molyb" amino acids 95 to 264 (170 residues), 165.9 bits, see alignment E=9.9e-53 PF03404: Mo-co_dimer" amino acids 292 to 392 (101 residues), 40.7 bits, see alignment E=3.6e-14

Best Hits

KEGG orthology group: K07147, (no description) (inferred from 67% identity to pna:Pnap_2692)

MetaCyc: 60% identical to sulfite:cytochrome c oxidoreductase molybdenum subunit (Starkeya novella)
Sulfite dehydrogenase. [EC: 1.8.2.1]

Predicted SEED Role

"Twin-arginine translocation pathway signal"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VWQ2 at UniProt or InterPro

Protein Sequence (409 amino acids)

>AO353_18085 oxidase (Pseudomonas fluorescens FW300-N2E3)
MSIDNRNTIKRRVFLQGASLVAAGLAFKPLHSRAAETEAQDFSNGTRELVAYPQKRPLMR
VTARPPHLETPFSVFNESILTPNDAFFVRYHLANLPTSIDADNYQLQIKGLVDKPLSLSL
AELKALGKTVEVVAVNQCSGNSRGYGSPRVFGAQLGNGSVGNARWTGIPLKAVLEQAGVQ
AGAKQVTFRGLDHPVLPTTPEFIKALGIDLALSDEPMIAWAMNGTDIPFLNGYPIKLIVP
GYFGTYWVKHLSEIEVIDHTFEGYFMEKAYRVPDNDCQCVPPGTVPDKTRPIGRLKVRSF
ITSLQPGAKVKLNEPITLKGFAFDGGHGIQSVELSEDGGRNWQLAVLGENLGNYSFREWT
LQWVPREKGKVGLQVRATNGQGEQQPVRALWNPAIYVKNNIETTPITVV