Protein Info for AO353_17990 in Pseudomonas fluorescens FW300-N2E3

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 transmembrane" amino acids 47 to 65 (19 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 232 to 261 (30 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details amino acids 311 to 328 (18 residues), see Phobius details amino acids 334 to 360 (27 residues), see Phobius details amino acids 372 to 391 (20 residues), see Phobius details amino acids 397 to 418 (22 residues), see Phobius details PF07690: MFS_1" amino acids 41 to 300 (260 residues), 127.6 bits, see alignment E=5.7e-41 amino acids 285 to 425 (141 residues), 43.2 bits, see alignment E=2.7e-15 PF00083: Sugar_tr" amino acids 66 to 226 (161 residues), 80.3 bits, see alignment E=1.4e-26

Best Hits

KEGG orthology group: None (inferred from 95% identity to pfo:Pfl01_1404)

Predicted SEED Role

"Sialic acid transporter (permease) NanT" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WI43 at UniProt or InterPro

Protein Sequence (430 amino acids)

>AO353_17990 MFS transporter (Pseudomonas fluorescens FW300-N2E3)
MSAPDTLDVAKPKIESRPGPFDWYRNINQQERRTFWSCKVGYGLDGMDTQMLSFVVPTLI
AMWGITTGQAGLIHTSTLIASAIGGWVAGILSDRIGRVRTLQLTVLWFAFFTFLCGFAQN
YEQLLIARTLMGFGFGGEWTAGAVLMGEVIRAKDRGKAVGMVQSGWALGWGLTAILYALL
FSILPPEDAWRALFILGIVPAIFVIFVRRLVKDPEIYRQAKARQEPSNPSKFYEIFAPGM
LSTTFRASLLTTGALGGYYAITSWLPTFLKNERGLSVLGTGGYLAMVILGSYAGYVISAY
LTDILGRKKNFILFAVGSFTIVLLYTQLPVSNGVMLWLGFPLGFFASGIFSGMGAFLTEL
FPTRIRGSGQGFCYNVGRALAALFPLLIGLLSQKVPLSVGIGAFAAVSYGVVILAALSLP
ETRGKQLDAQ