Protein Info for AO353_17580 in Pseudomonas fluorescens FW300-N2E3

Annotation: tricarboxylic transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03401: TctC" amino acids 58 to 326 (269 residues), 81.4 bits, see alignment E=3.1e-27

Best Hits

KEGG orthology group: K07795, putative tricarboxylic transport membrane protein (inferred from 94% identity to pfl:PFL_1439)

Predicted SEED Role

"Tricarboxylate transport protein TctC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H0D1 at UniProt or InterPro

Protein Sequence (329 amino acids)

>AO353_17580 tricarboxylic transporter (Pseudomonas fluorescens FW300-N2E3)
MDLSLRKVALAASCLLFAGPLLADVAGEPKRPECIAPASPGGGFDLTCKLAQSALVNEKI
LTKPMRVTYMPGGVGAVAYNAVVAQRPADAGTLVAWSSGSLLNLAQGKFGRFDENAVRWL
AAVGTSYGAIAVKSDSPYKNLDDLVQALKKDPSKVVIGSGGTVGSQDWMQTALIAKAAGI
NPRDLRYVALEGGGEIATALLGGHIQVGSTDISDSMPHIQSGDMRLLAVFANERLDEPEM
KDIPTAKEQGYDIVWPVVRGFYLGPKVSDAEYAWWKNAFDKLLASEDFAKLRDQRELFPF
AMTGPELDTYVKKQVADYKLLAKEFGLIQ