Protein Info for AO353_17570 in Pseudomonas fluorescens FW300-N2E3

Annotation: tripartite tricarboxylate transporter TctA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 transmembrane" amino acids 15 to 39 (25 residues), see Phobius details amino acids 45 to 72 (28 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details amino acids 140 to 164 (25 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 249 to 277 (29 residues), see Phobius details amino acids 307 to 325 (19 residues), see Phobius details amino acids 330 to 350 (21 residues), see Phobius details amino acids 356 to 376 (21 residues), see Phobius details amino acids 385 to 428 (44 residues), see Phobius details amino acids 434 to 452 (19 residues), see Phobius details amino acids 466 to 490 (25 residues), see Phobius details PF01970: TctA" amino acids 20 to 440 (421 residues), 492.4 bits, see alignment E=4.8e-152

Best Hits

KEGG orthology group: K07793, putative tricarboxylic transport membrane protein (inferred from 97% identity to pba:PSEBR_a1329)

Predicted SEED Role

"Tricarboxylate transport membrane protein TctA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WJT7 at UniProt or InterPro

Protein Sequence (504 amino acids)

>AO353_17570 tripartite tricarboxylate transporter TctA (Pseudomonas fluorescens FW300-N2E3)
MDTLNYLGQGFGVALTPYNLVTALCGTLIGTVVGLLPGLGPINGVALLIPIAFALGLPPE
SALILLAAVYLGCEYGGRISSILLNIPGEASTVMTTLDGYPMARQGMAGVALSLSAWSSF
IGAFIATCGMVLFAPLLAKWAIAFGPAEYFVLMVFAIVCLGGMAGDRPLKTFIAALIGLF
LSCVGIDANSGVYRFTGDNIHLTDGIQFVVLVLGLFSISEILLLLEKTHHGQEAVKATGR
MMFNFKEAASVFAVNIRCGVLGFIMGVLPGAGATLASAVAYMTEKRIAGASGTFGQGDKR
GLAAPETAIGGAACGALVPMLTLGVPGSGTTAVMIGALSLYNITPGPLLFQQQPDIVWGL
IASLFVANVMLVILNIPMIRIFTRILAVPNWALVPVIAIITGIGVYAVHATTFDLFLMIG
IGIFGYILRKLDFPLSPVLLGFILGGLMEQNLRRALSISNGALEILWSSPITFGCWVLTA
IMLLMPILRIWRKRSVARRAIADV