Protein Info for AO353_17500 in Pseudomonas fluorescens FW300-N2E3

Annotation: bb3-type cytochrome oxidase subunit IV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00510: COX3
  • amino acids 49 to 237 (189 residues), 78.8 bits, E=3.2e-26

Best Hits

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 78% identity to har:HEAR1118)

Predicted SEED Role

"Alternative cytochrome c oxidase polypeptide CoxP (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration II (cytochrome c) (yeast) (3/4 steps found)
• arsenite to oxygen electron transfer (1/2 steps found)
• arsenite to oxygen electron transfer (via azurin) (1/3 steps found)
• Fe(II) oxidation (3/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

See A0A0N9WKL9 at UniProt or InterPro

Protein Sequence (237 amino acids)

>AO353_17500 bb3-type cytochrome oxidase subunit IV (Pseudomonas fluorescens FW300-N2E3)
MASHPLAPVESSSSNPPSSPPATGWQGIANDWASDREAFRQVPWGKAMMWIFLLSDTFVF
TCFLTGYMSVRMTITSAWPNPSEVFALTIGGREIPLILIAIMTFVLISSSGTMAMAVNFA
YRRDRAKTAALMLATAAFGVTFVSMQAFEWSKLIAEGVRPWGNPMGAAQFGASFFMITGF
HGLHVSVGVIYLSIVAMKVLRGDYERSGNYQIVEIAGLYWHFVDLVWVFIFAFFYLW