Protein Info for AO353_17350 in Pseudomonas fluorescens FW300-N2E3

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 50 to 64 (15 residues), see Phobius details PF02770: Acyl-CoA_dh_M" amino acids 76 to 163 (88 residues), 37.3 bits, see alignment E=1.3e-13

Best Hits

KEGG orthology group: None (inferred from 82% identity to pfo:Pfl01_1288)

Predicted SEED Role

"Acyl-CoA dehydrogenase; probable dibenzothiophene desulfurization enzyme"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WEB3 at UniProt or InterPro

Protein Sequence (293 amino acids)

>AO353_17350 acyl-CoA dehydrogenase (Pseudomonas fluorescens FW300-N2E3)
MPWQVLLNCNQRQPENPDLAEGYATLLQVLGAVTPFELAVRGGRMMATPGLAFLVGYQAA
LRMLWPSAPPSLGALCATEQRSLRPADLQTRLKDLRLSGRKDFVTAGDAADWLLIAARSE
EQGESARLSLAVVYPGEPGVRVEKLPAIALMPDISHGRLFLDNALCELLAGDGWDAYVKP
FRTLEDIYVLSAMSAWLYGVGQDSAWPQDLQLKLLALLAGCAEVSRQPPNSSAGHVLLGG
LFAQFDGLKSALNEAFAAGPPQWAALWTRDQAVLDLAAGARAKRLAKALAGSD