Protein Info for AO353_17095 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 PF05114: DUF692" amino acids 25 to 289 (265 residues), 352.3 bits, see alignment E=7.5e-110

Best Hits

Swiss-Prot: 60% identical to Y081_PHOLL: UPF0276 protein plu0081 (plu0081) from Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)

KEGG orthology group: K09930, hypothetical protein (inferred from 82% identity to pfs:PFLU1340)

Predicted SEED Role

"Uncharacterized protein conserved in bacteria, NMA0228-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WJL2 at UniProt or InterPro

Protein Sequence (297 amino acids)

>AO353_17095 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
MMTTSALHNVHPHTQALASELPPRAGLGLKTEHFGAVLDTRPDIGFFEVHAENYMVAGGP
FHHYLGLIREQYPLSLHGVGLSIGGEGPLNSEHLARLAKLIERYQPQSFSEHLAWSSHGP
VFLNDLLPLAYNESTLQRVCEHIDQVQQHLKRPMLLENPATYLQFQHSGMEEACFITDVI
RRTGCGLLLDVNNVYVSCINHQRDPLAYIDALPLHAVGEIHLAGFAEDTDSLGDRLLLDD
HGAPIDNAVWTLYTQVLERVGPVATLIERDNQVPAFSVLLAEARQADELLGYTEVHR