Protein Info for AO353_16995 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF17775: UPF0225" amino acids 30 to 127 (98 residues), 102.1 bits, see alignment E=2.6e-33 PF02810: SEC-C" amino acids 136 to 153 (18 residues), 34.1 bits, see alignment (E = 2e-12)

Best Hits

Swiss-Prot: 94% identical to Y1218_PSEPF: UPF0225 protein Pfl01_1218 (Pfl01_1218) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K09858, SEC-C motif domain protein (inferred from 91% identity to pfl:PFL_1273)

Predicted SEED Role

"UPF0225 protein YchJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H0B7 at UniProt or InterPro

Protein Sequence (158 amino acids)

>AO353_16995 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
MSTSICPCGSGTLLDACCGHYHAGHPAPCAEALMRSRYSAYVLGLIDYLVATTLPAQQAG
LDRQSISEWSAQSTWLGLEVESSEVFGGQPEHAFVTFTARWHDSTGEHSHRERSSFVQNA
GRWYFIDPTVQLKAGRNDACPCASGQKFKKCCASYFTV