Protein Info for AO353_16960 in Pseudomonas fluorescens FW300-N2E3

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 106 to 124 (19 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 20 to 122 (103 residues), 49.6 bits, see alignment E=2.3e-17 PF00528: BPD_transp_1" amino acids 45 to 227 (183 residues), 60.6 bits, see alignment E=8.8e-21

Best Hits

Swiss-Prot: 61% identical to HISM_SALTI: Histidine transport system permease protein HisM (hisM) from Salmonella typhi

KEGG orthology group: K10015, histidine transport system permease protein (inferred from 94% identity to pba:PSEBR_a1153)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisM (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WHP0 at UniProt or InterPro

Protein Sequence (236 amino acids)

>AO353_16960 amino acid ABC transporter permease (Pseudomonas fluorescens FW300-N2E3)
MIELLQDYWKPFLYTDGYHITGLAMTMWLLSASIFIGFLVSIPLSIARVSSKLYVRWPVQ
FYTYLFRGTPLYIQLLICYTGIYSLAAVRAQPVLDAFFRDAMNCTILAFALNTCAYTTEI
FAGAIRSMNHGEVEAAKAYGLTGWKLYAYVIMPSALRRSLPYYSNEVILMLHSTTVAFTA
TVPDVLKVARDANSATFLTFQSFGIAALIYLTVTFALVGLFRLAERRWLAFLGPTH