Protein Info for AO353_16955 in Pseudomonas fluorescens FW300-N2E3

Annotation: succinylglutamate desuccinylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 PF04952: AstE_AspA" amino acids 32 to 358 (327 residues), 57.1 bits, see alignment E=9.2e-20

Best Hits

KEGG orthology group: K06987, (no description) (inferred from 87% identity to pfo:Pfl01_1207)

Predicted SEED Role

"Succinylglutamate desuccinylase/aspartoacylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H0B6 at UniProt or InterPro

Protein Sequence (372 amino acids)

>AO353_16955 succinylglutamate desuccinylase (Pseudomonas fluorescens FW300-N2E3)
MRHQIHDLLAPLPGTARQIHSFHFGPTQAKGKIYIQSSLHADEMPGMLVAWHLKLRLAEL
EAAGRLRSEIVLVPVANPIGLEQVLMDVPLGRYELESGQNFNRWFVDLGEEVGNEIEGQL
NDDPQHNLELIRSSLRNALARQTARTQLQSQRLTLQTLACDADMVLDLHCDFEAVAHLYT
TPEAWPQVEPLARYIGAEASLLATDSGGHSFDECFTLVWWQMQERFGEHFDIPLGSFSVT
VELRGQGDVNHPLASLDCQALIDYLVHFGAIEGEAAPLPELPYPATPLAAVEPVATPVGG
LLVYHVLPGEYLEAGQLIAEIIDPIGDRVTPVHCANAGLLYARSTRRMATAGMVIAHVAG
LEAYRTGYLLSP