Protein Info for AO353_16925 in Pseudomonas fluorescens FW300-N2E3

Annotation: AmpG family muropeptide MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 29 to 30 (2 residues), see Phobius details amino acids 53 to 69 (17 residues), see Phobius details amino acids 90 to 107 (18 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 230 to 249 (20 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details amino acids 317 to 342 (26 residues), see Phobius details amino acids 355 to 376 (22 residues), see Phobius details amino acids 383 to 402 (20 residues), see Phobius details amino acids 411 to 434 (24 residues), see Phobius details amino acids 446 to 465 (20 residues), see Phobius details amino acids 473 to 496 (24 residues), see Phobius details PF13000: Acatn" amino acids 20 to 152 (133 residues), 29.5 bits, see alignment E=2.9e-11 PF07690: MFS_1" amino acids 21 to 321 (301 residues), 44.8 bits, see alignment E=8.3e-16 amino acids 324 to 515 (192 residues), 43 bits, see alignment E=3e-15 TIGR00901: AmpG-like permease" amino acids 29 to 455 (427 residues), 430.7 bits, see alignment E=2.6e-133

Best Hits

KEGG orthology group: K08218, MFS transporter, PAT family, beta-lactamase induction signal transducer AmpG (inferred from 90% identity to pfo:Pfl01_1198)

Predicted SEED Role

"AmpG permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WWW3 at UniProt or InterPro

Protein Sequence (520 amino acids)

>AO353_16925 AmpG family muropeptide MFS transporter (Pseudomonas fluorescens FW300-N2E3)
MPRKTWRAALAAYASPSTLVLLLLGFAAGLPYMLVFSTLSVWLREAGVARETIGYASLIG
LAYAFKWVWSPLLDQWRLPLLGKLGRRRSWLVLAQILLVLGLIGMGFCDPQKHLSWLIAI
AVLVAFASATQDIAVDAYRLEIVDDTRQAALAASYMSGYRVAALLATAGALFIAEGFGST
GFNYKHSAWTGTYALFGLLMIPALVTTLLMREPPVPLRTQLSAGRYSFVHQLASVFVLIV
LLVSVPAMFTQLYNTDFASVITGAMSPLDLLLEDRAFLRALLYIILTSLCLSTMGRRGLA
PVLTPVNDFVVRYRWQAFLLLGLIATYRMSDTVMGVMANVFYIDLGFTKDQIAGVSKIFG
LIMTLVGAGMGGLLIVRFGILPILFIGGFASAATNLLFVMLADMGANLEMLIVTISLDNF
SSGMATSAFVAYLSSLTNLKFSATQYALLSSIMLLLPRLIGGYSGVMVEKYGYHNFFIIT
ALLGVPTLLLIALHWFQENRREGPTPTPEPAQTATAVEES