Protein Info for AO353_16875 in Pseudomonas fluorescens FW300-N2E3

Annotation: ribosomal protein S12 methylthiotransferase RimO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 TIGR01125: ribosomal protein S12 methylthiotransferase RimO" amino acids 10 to 440 (431 residues), 577.3 bits, see alignment E=2.3e-177 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 10 to 441 (432 residues), 337.4 bits, see alignment E=1.2e-104 PF00919: UPF0004" amino acids 10 to 93 (84 residues), 72.8 bits, see alignment E=2.9e-24 PF04055: Radical_SAM" amino acids 147 to 325 (179 residues), 83.6 bits, see alignment E=2.9e-27 PF18693: TRAM_2" amino acids 382 to 444 (63 residues), 79 bits, see alignment E=3.6e-26

Best Hits

Swiss-Prot: 97% identical to RIMO_PSEPF: Ribosomal protein S12 methylthiotransferase RimO (rimO) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K14441, ribosomal protein S12 methylthiotransferase [EC: 2.-.-.-] (inferred from 98% identity to pba:PSEBR_a1136)

MetaCyc: 71% identical to ribosomal protein S12 methylthiotransferase RimO (Escherichia coli K-12 substr. MG1655)
RXN0-6366 [EC: 2.8.4.4]

Predicted SEED Role

"Ribosomal protein S12p Asp88 (E. coli) methylthiotransferase" in subsystem Ribosomal protein S12p Asp methylthiotransferase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.8.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VR62 at UniProt or InterPro

Protein Sequence (444 amino acids)

>AO353_16875 ribosomal protein S12 methylthiotransferase RimO (Pseudomonas fluorescens FW300-N2E3)
MSTTTPANPKVGFVSLGCPKALVDSERILTQLRMEGYDVVSTYQDADVVVVNTCGFIDSA
KAESLEVIGEAIKENGKVIVTGCMGVEEGNIRNVHPSVLAVTGPQQYEQVVNAVHDVVPP
RKDHNPLIDLVPPQGIKLTPRHYAYLKISEGCNHSCSFCIIPSMRGKLVSRPVGDVLDEA
QRLVKSGVKELLVISQDTSAYGVDVKYRTGFWNGAPVKTRMTELCEALSTLGVWVRLHYV
YPYPHVDELIPLMAAGKILPYLDIPFQHASPKVLKAMKRPAFEDKTLARIKNWREICPDL
IIRSTFIVGFPGETEEDFQYLLNWLTEAQLDRVGCFQYSPVEGAPANDLDLEIVPDEVKQ
DRWDRFMAHQQAISSARLQMRIGREIEVLVDEVDEQGAVGRCFFDAPEIDGNVFIDNGSN
LKPGDKVWCKVTDADEYDLWAEQI