Protein Info for AO353_16870 in Pseudomonas fluorescens FW300-N2E3

Annotation: acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13508: Acetyltransf_7
  • amino acids 56 to 127 (72 residues), 45 bits, E=2.3e-15
• PF13673: Acetyltransf_10
  • amino acids 60 to 131 (72 residues), 48.6 bits, E=1.7e-16
• PF08445: FR47
  • amino acids 64 to 128 (65 residues), 22.2 bits, E=2.2e-08
• PF00583: Acetyltransf_1
  • amino acids 72 to 125 (54 residues), 41.8 bits, E=2.4e-14

Best Hits

KEGG orthology group: K03827, putative acetyltransferase [EC: 2.3.1.-] (inferred from 90% identity to pfo:Pfl01_1190)

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

See A0A0N9WLI0 at UniProt or InterPro

Protein Sequence (157 amino acids)

>AO353_16870 acetyltransferase (Pseudomonas fluorescens FW300-N2E3)
MRHHSVIHTPKHSDYEELTRVWEASVRATHDFLPDSYIELLKNLVLTRYLDAVMLICTRD
RHQHITGFAGVAAGKIEMLFIAPEHRGEGLGKQLLNYAMEHLNADQLDVNEQNPQALGFY
FKQGFEVIGRSEIDGMGQPYPLLHMRLKQANQQARRG