Protein Info for AO353_16705 in Pseudomonas fluorescens FW300-N2E3

Annotation: phage tail protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 733 transmembrane" amino acids 463 to 484 (22 residues), see Phobius details amino acids 598 to 617 (20 residues), see Phobius details amino acids 622 to 641 (20 residues), see Phobius details TIGR01760: phage tail tape measure protein, TP901 family, core region" amino acids 111 to 475 (365 residues), 101.2 bits, see alignment E=3.1e-33 PF10145: PhageMin_Tail" amino acids 183 to 360 (178 residues), 53.5 bits, see alignment E=1.5e-18

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H0B0 at UniProt or InterPro

Protein Sequence (733 amino acids)

>AO353_16705 phage tail protein (Pseudomonas fluorescens FW300-N2E3)
MADDRYSLKYAALNDSGLAFGNTSLTTAVTSVASAQGTGTSARDQMSGLGLALENVGLKL
GLLTTAIESLTLKLSSQRLLPQTMGAGAKSEPASEQKSAGKPGSGIEPPDLLKPAIAMDS
AMADLKQATQFTPRQSEEMAQSTQHIASAPLVAAGGTKAVDLVKIESLAARAGIVSDLPN
ASDRQLELQRFASDAGVAASAFKMPAMDVAEMMVGWRTSMKLNGAQAFDLADATNHLGKI
PNGAKAADIGAVLQRDGAAATAAGLSPALAAALTAALLNTGTQKAEAGVALKSITTVMGK
GDQASATEQAAWKQLGLEPKAVASGLRDKDAAPGTVMSVLAALNAQPAENRATLASTLFG
DGDKPALNMAQNLTDVNGAFWQVKDKAQYATSELGDKGSVRQDALALSKTRQGQWNVLSA
SNDRLSVATGNALAPVTDSSLHSLGSLVDGLSELAEASPKTTAAIVLVAAAIKPLVGALF
KAITDELTNRMAKRVLGGVAARLPDRLGEAISDDFRNKGRTDKPNASETNRSPEPRNGPS
VRVSPRGSRASTPRWGGLTASMRSIPRKLPGPLKGVSAVADVTEGLLVGNTRMVGAGLGA
AGGGWAGASAGAAAGAALGSVVPLLGTAIGGVLGGLVGGWMGSESGAWLGEKLAAPADKL
AAPDQVSKDLTNTQATSQQNALTANIYINGQDQASAAQLANLVVQHISGQFGLMTTTNQL
AVRRDTALTDGVA